3300000899: Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 7

Overview

Basic Information

• IMG/M Taxon OID: 3300000899
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0075432 | Gp0054746 | Ga0001930
• Sample Name: Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 7
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 9353869
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): forest biome → tropical forest → forest soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Luquillo Experimental Forest Soil, Puerto Rico
• Coordinates
  • Lat. (^o): 18.0
  • Long. (^o): -65.0
  • Alt. (m): N/A
  • Depth (m): .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072153	Metagenome / Metatranscriptome	121	N

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12296J12826_101146	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium	660

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12296J12826_101146	JGI12296J12826_1011461	F072153	DVWVQELAEEVDIRTGRERIAMHGKAQRKHSVLTFPPHHQGIPLGARRAEGKILIHLRQSAPEVEKRSLAAYERVANRGGR*