x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300000896
3300000896: Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3
Overview
| Basic Information |
| IMG/M Taxon OID | 3300000896 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0071004 | Gp0054040 | Ga0002408 |
| Sample Name | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 5066886 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota | 1 |
| Not Available | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | forest biome → solid layer → forest soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information |
| Location | El Dorado National Forest, Georgetown, California, USA |
| Coordinates | Lat. (o) | 38.88 | Long. (o) | -120.64 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F033047 | Metagenome / Metatranscriptome | 178 | Y |
| F054123 | Metagenome / Metatranscriptome | 140 | Y |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| JGI11815J12869_100002 | JGI11815J12869_1000022 | F033047 | MKNFIQTTKKTINILLVNFTLAKFAGAFVTIIMVALIKYMVSGNFHLEYCEL*NNVTIGLFG*TINTAAIG*FSEYLGVKGINFNLNQFLYGYHTMGAGDSYSLKDFKVKLYNAMESDNGSDPSKQIDKGKGIDKGFNEGNDESGAKPLDKGKGIDRRVHRIELGPGHCTEPPLVT*SRVFPGLDPASVFFPKTINPGPGFNVPGGEVPLRDDICKHIDYNSHILKQFKNMDLKTALEQRDNYLKYIHVINQKTLYAQETLSKVPEIPTNEYEHRLKNTIL*DLQNLNMQKVRAEAKATLLNSRIEFIQINRKPNE* |
| JGI11815J12869_101150 | JGI11815J12869_1011501 | F054123 | MNILHAITLAALLHGSPAPVVTCHTGTVSYKFVGAPGATFAYGGTKYSVPASGWIELLSERDGKGYLAANGKTLPLDVWPIDAFGTRTVPLQPTPSISGGGDAISTINN* |
