NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000669

3300000669: Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24



Overview

Basic Information
IMG/M Taxon OID3300000669 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0075432 | Gp0054743 | Ga0001947
Sample NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 24
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size4044798
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameTropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biometropical forestforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)N/ADepth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005929Metagenome / Metatranscriptome386Y
F091903Metagenome107N
F104209Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12293J11934_100194All Organisms → cellular organisms → Bacteria1115Open in IMG/M
JGI12293J11934_100558All Organisms → cellular organisms → Bacteria → Proteobacteria669Open in IMG/M
JGI12293J11934_101100Not Available513Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12293J11934_100194JGI12293J11934_1001942F104209RRQERRNGHGGAGTHAHSTLSAETTHVQVFYRFHPLYSSTLQILRRPKRGDGAVCVSDPMGRRLKIPMWMLLPNSAEMKIAEQAYLSKEALLSLVLLVSTPREIENRVHANLLQAVVDTCKGGQRATTTTPGAGDRKSGGHGADRRRDTNRTDRSHGPHSGGGLSNGRRKSR*
JGI12293J11934_100558JGI12293J11934_1005581F091903MGHRDKKRHPGWLQPRWERQKRDTAARVEAAVRALQKDHAEVTYASICKRVSILFGLSISPNTIKRNELSYRIYMASRRPPRRKQLRESVLMQLINSASGPEKRSMWSKTAR
JGI12293J11934_101100JGI12293J11934_1011002F005929MRENXSLLSFWGLVFSLIAVTLFVVIYSYQKSKYANRRIVEDLRQRSVDVYLAAKTPEAESDSKMFRAASNEIERLRAETRVLFWLIIAMNTAVIIIFILAYRYF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.