3300000591: Groundwater microbial communities from well in New Jersey, USA, that are chlorine contaminated, sample 1

Overview

Basic Information

• IMG/M Taxon OID: 3300000591
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0083744 | Gp0055153 | Ga0011516
• Sample Name: Groundwater microbial communities from well in New Jersey, USA, that are chlorine contaminated, sample 1
• Sequencing Status: Permanent Draft
• Sequencing Center: University of California, Berkeley
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 41408347
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Groundwater Microbial Communities From Well In New Jersey, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater → Groundwater Microbial Communities From Well In New Jersey, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater biome → well → groundwater
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: New Jersey, USA
• Coordinates
  • Lat. (^o): 39.86
  • Long. (^o): -74.34
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030981	Metagenome	183	Y
F096529	Metagenome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
TCEJC06_1000388	All Organisms → cellular organisms → Bacteria	5835

Sequences

Scaffold ID	Protein ID	Family	Sequence
TCEJC06_1000388	TCEJC06_10003882	F096529	VKRKDFIEGFEPQIVRISGKPKVIGYIKGNTFRSVVKYSKHVLYKREGRPPAIAKEAWVYRNLIRPRCRLWEVFDEERNLLLRTTIAKFDAHCEEWHHNDLVQLLLEEPYWQIERLGPPKLTQGKLF*
TCEJC06_1000388	TCEJC06_10003883	F030981	MGKVRRCDKRCHTAKGIRCKCWCGGFFHGSAGASNRAALAQGATELLEEHGFKKDATAYVGQEELPMKDLPGAEAR*