3300000511: Marine sediment microbial community from Fremont, CA, USA - Pond A23 Sediment 1

Overview

Basic Information

• IMG/M Taxon OID: 3300000511
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053056 | Gp0053347 | Ga0000191
• Sample Name: Marine sediment microbial community from Fremont, CA, USA - Pond A23 Sediment 1
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 53433178
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → pond → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Alviso Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.475383
  • Long. (^o): -121.9729
  • Alt. (m): N/A
  • Depth (m): .09

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038111	Metagenome	166	N

Associated Scaffolds

Scaffold	Taxonomy	Length
P_A23_Sed_1_FmtDRAFT_1005025	Not Available	1422

Sequences

Scaffold ID	Protein ID	Family	Sequence
P_A23_Sed_1_FmtDRAFT_1005025	P_A23_Sed_1_FmtDRAFT_10050251	F038111	PCPSFYYEAMIPSKVAVANKPEYTIWLENYKNIATFIHADVYKYNKTIRQEFGKDLNLLANLHNSPLYVLTHKDNKKLKKFMSIYGLVLDHTPLCDDGIEREVYRLDRRQ*