| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000489 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0073241 | Gp0054316 | Ga0011586 |
| Sample Name | ZC3D64 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Sao Paulo |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 20493222 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Compost Microbial Communities From Sao Paulo Zoo, Brazil |
| Type | Engineered |
| Taxonomy | Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sao Paulo Zoo Park | |||||||
| Coordinates | Lat. (o) | -23.651079 | Long. (o) | -46.620668 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088555 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| ZC3D64_110661 | Not Available | 674 | Open in IMG/M |
| ZC3D64_111485 | Not Available | 592 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| ZC3D64_110661 | ZC3D64_1106612 | F088555 | MALRMYFDETVSSLVRDDISPTLGSPDTYEGPAEGGSVERKLYLYSDNFQRTYSNVQISALNADADVQIHYALDQGGQPGTYQTNLQLPDGDYQTPVPVWVKVTFAPTTEPTLRTDLRHHLQWLEAIAG* |
| ZC3D64_111485 | ZC3D64_1114852 | F088555 | MAIRMYFDETVSSLVRDDISPTLGSPDTYEGPAEGGSVERKLYLYSDNFQRTYSNVQISALNADADVQIHYALDQGGQPGTYQTNLQLPDGDYQTPVPVWVKVTF |
| ⦗Top⦘ |