3300000426: Marine sediment microbial community from Union City, CA, USA - Pond 1C Sediment 3

Overview

Basic Information

• IMG/M Taxon OID: 3300000426
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053056 | Gp0053721 | Ga0026743
• Sample Name: Marine sediment microbial community from Union City, CA, USA - Pond 1C Sediment 3
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 90642744
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → pond → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Eden Landing Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.569083
  • Long. (^o): -122.103267
  • Alt. (m): N/A
  • Depth (m): .29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094909	Metagenome	105	Y
F102576	Metagenome	101	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
P_1C_Sed_3_UnCtyDRAFT_1000884	All Organisms → cellular organisms → Bacteria	6404
P_1C_Sed_3_UnCtyDRAFT_1003862	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2421

Sequences

Scaffold ID	Protein ID	Family	Sequence
P_1C_Sed_3_UnCtyDRAFT_1000884	P_1C_Sed_3_UnCtyDRAFT_10008845	F094909	MVVMYNEKILDWVEGYVLTRMLIFGDFVGTVDRTELMFDLDTNSDYFRIHEGQRIQALSLPVKSRRLCTLLGEIEACFQRGWPLLDAGEWTKADFDEVYDLSMQISDEIMLLREEFQQKMPSEPRPSSVNPD*
P_1C_Sed_3_UnCtyDRAFT_1003862	P_1C_Sed_3_UnCtyDRAFT_10038622	F102576	MNDLLLLERYFPGGKLEGGIALANRLDWGLSVQMSGNDYVVSSGNEPILRTESKDALQSFIYGMGLAYAVLPENLFLALEKTLREL*