3300000409: Marine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 1

Overview

Basic Information

• IMG/M Taxon OID: 3300000409
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053056 | Gp0053724 | Ga0026676
• Sample Name: Marine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 1
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 24779847
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → pond → sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Eden Landing Ponds, San Francisco, CA, USA
• Coordinates
  • Lat. (^o): 37.569167
  • Long. (^o): -122.1019
  • Alt. (m): N/A
  • Depth (m): .13

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048391	Metagenome / Metatranscriptome	148	Y
F052283	Metagenome / Metatranscriptome	143	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
P_2C_Sed_1_UnCtyDRAFT_100888	All Organisms → cellular organisms → Bacteria	1493
P_2C_Sed_1_UnCtyDRAFT_106056	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	593

Sequences

Scaffold ID	Protein ID	Family	Sequence
P_2C_Sed_1_UnCtyDRAFT_100888	P_2C_Sed_1_UnCtyDRAFT_1008882	F052283	MNSRQKSVFTGAILGAALGAVGGYLFTRGLDLSREGREQPDELSLKSVPPGEMVKVFIAIMAVLRGIAELGERL*
P_2C_Sed_1_UnCtyDRAFT_106056	P_2C_Sed_1_UnCtyDRAFT_1060561	F048391	SVEPINTLDYLNELLGKGYVIKGPRKDSSRDLISFKAFLKKGKEFAPEGWLLHMGYEFIEPNTFTKGHKIAYKIIDEIPDERFNSNYTLVKENREIPLYLKVAVLKAE*