3300000354: Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - CD6A

Overview

Basic Information

• IMG/M Taxon OID: 3300000354
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0067861 | Gp0054619 | Ga0026141
• Sample Name: Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - CD6A
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 90602774
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Elkhorn Slough, Monterey Bay, California, USA
• Coordinates
  • Lat. (^o): 36.82188
  • Long. (^o): -121.744
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024806	Metagenome / Metatranscriptome	204	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
ElkS_mat_CD6ADRAFT_1026176	Not Available	590

Sequences

Scaffold ID	Protein ID	Family	Sequence
ElkS_mat_CD6ADRAFT_1026176	ElkS_mat_CD6ADRAFT_10261761	F024806	MVTNSNFNFTSNSIITLELPFSEHIEELRQRLFLVFGIILLLTCLAFIEVKSLVKILELPIS