3300000347: Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - CD2A

Overview

Basic Information

• IMG/M Taxon OID: 3300000347
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0067861 | Gp0053859 | Ga0026496
• Sample Name: Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - CD2A
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 152203650
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Elkhorn Slough, Monterey Bay, California, USA
• Coordinates
  • Lat. (^o): 36.82188
  • Long. (^o): -121.744
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034932	Metagenome / Metatranscriptome	173	Y
F062769	Metagenome / Metatranscriptome	130	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
ElkS_mat_CD2ADRAFT_1009709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	2090

Sequences

Scaffold ID	Protein ID	Family	Sequence
ElkS_mat_CD2ADRAFT_1009709	ElkS_mat_CD2ADRAFT_10097092	F034932	MRTVRIESESHNLIAGFVAGIEWVNDSAVAVVDLQYCGRTAFVVLEDRDGSGEDAVLRLTSDGLADEE*
ElkS_mat_CD2ADRAFT_1009709	ElkS_mat_CD2ADRAFT_10097094	F062769	MTDLDAFSNWLTSATRAAILAVRARVYLAREQHPAWRSATNTILKRITQELAARGEYDRRCVA*