3300000295: Human fecal microbial communities from Cork, Ireland - EM334

Overview

Basic Information

• IMG/M Taxon OID: 3300000295
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0045762 | Gp0053772 | Ga0011198
• Sample Name: Human fecal microbial communities from Cork, Ireland - EM334
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Genomics Institute (BGI), Macrogen
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 97355576
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal distal gut

Location Information

• Location: Cork, Ireland
• Coordinates
  • Lat. (^o): 51.907
  • Long. (^o): -8.472
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071325	Metagenome	122	N

Associated Scaffolds

Scaffold	Taxonomy	Length
EM334_1068126	All Organisms → cellular organisms → Bacteria	1375

Sequences

Scaffold ID	Protein ID	Family	Sequence
EM334_1068126	EM334_10681262	F071325	LRFHKFQYCSIFKVLLALLSDSSIIISKVVPFVKHFFDIFLSFPNAFLKAFHPHAVRFPAAFLLVHRFYLDFEELLSCATAYL*