3300000249: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P12 1000m

Overview

Basic Information

• IMG/M Taxon OID: 3300000249
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046785 | Gp0054006 | Ga0026088
• Sample Name: Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2009 P12 1000m
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 9631090
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine aphotic zone → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: P12, Pacific Ocean
• Coordinates
  • Lat. (^o): 48.97
  • Long. (^o): -130.666667
  • Alt. (m): N/A
  • Depth (m): 1000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004642	Metagenome / Metatranscriptome	429	Y
F101338	Metagenome	102	N

Associated Scaffolds

Scaffold	Taxonomy	Length
LPfeb09P121000mDRAFT_102282	Not Available	624
LPfeb09P121000mDRAFT_103205	Not Available	545

Sequences

Scaffold ID	Protein ID	Family	Sequence
LPfeb09P121000mDRAFT_102282	LPfeb09P121000mDRAFT_1022821	F101338	FELYFHSYIFSLSIAVLGLVARAPAVYMPFFKRILCEGIISAVFLRLEIQVFVPCLTLLTLLTGVQ*
LPfeb09P121000mDRAFT_103205	LPfeb09P121000mDRAFT_1032051	F004642	VWLNKSKKFYDVPFWQFTMDGIQWMVLDERHGSASQFYSHYKLAKGHVICTGXGFGTREQWLASKPEVTKITVLEKFKEVIDYHKDIGTKWHDKIEIINCDANDYKGSCDFLSIDHYEYDXVLRILDSIKTVCNNITCESAWFWMLEPWIRLGYITDNTENPTIIPMKIRYGGKENDILE