3300000245: Hypersaline viral and bacterial communities from Bras del Port, Santa Pola, Spain - Pena Hueca_Large contigs

Overview

Basic Information

• IMG/M Taxon OID: 3300000245
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0069917 | Gp0051881 | Ga0011187
• Sample Name: Hypersaline viral and bacterial communities from Bras del Port, Santa Pola, Spain - Pena Hueca_Large contigs
• Sequencing Status: Permanent Draft
• Sequencing Center: Lifesequencing S.L.
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3486415
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → environmental samples → uncultured virus	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Unclassified → Hypersaline Samples → Hypersaline Viral And Bacterial Communities From Bras Del Port, Santa Pola, Spain

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → saline evaporation pond → hypersaline water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Hypersaline (saline)

Location Information

• Location: Pena Hueca, Spain
• Coordinates
  • Lat. (^o): 39.516667
  • Long. (^o): -3.333333
  • Alt. (m): N/A
  • Depth (m): .5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072017	Metagenome	121	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
PenaHueca_101311	All Organisms → Viruses → environmental samples → uncultured virus	1002

Sequences

Scaffold ID	Protein ID	Family	Sequence
PenaHueca_101311	PenaHueca_1013112	F072017	MSLNQTPSLESQSDTNVKRIVHQHDEIHAVTQEHIDVLDEDDRLLDFYEWQQIIRASETTVRRLAYAETGVDQ*