NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000165

3300000165: Delisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY59_SOAP_k21_Abyss_k55_GAA



Overview

Basic Information
IMG/M Taxon OID3300000165 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0047590 | Gp0053780 | Ga0010835
Sample NameDelisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY59_SOAP_k21_Abyss_k55_GAA
Sequencing StatusPermanent Draft
Sequencing CenterJ. Craig Venter Institute (JCVI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size465053456
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDelisea Pulchra's Surface Microbial Communities From Botany Bay, Sydney, Australia
TypeHost-Associated
TaxonomyHost-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra's Surface → Delisea Pulchra's Surface Microbial Communities From Botany Bay, Sydney, Australia

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationBotany Bay, Sydney, NSW, Australia
CoordinatesLat. (o)-33.991017Long. (o)151.232433Alt. (m)N/ADepth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037503Metagenome / Metatranscriptome168Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
BBAY59_c10031135Not Available1365Open in IMG/M
BBAY59_c10048426All Organisms → cellular organisms → Bacteria865Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
BBAY59_c10031135BBAY59_100311351F037503EVELPIGLGGFTAYQPLMNSECHDTASAVRAWVLRSMSERERTXXXS*
BBAY59_c10048426BBAY59_100484261F037503EVELPIGLGGFTAYQPLTNSECHYTAAAVRLWVLRSTAERGTTQTIS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.