| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000060 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046786 | Gp0051899 | Ga0026009 |
| Sample Name | Panchlora_midgut_metagenome |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 765263861 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Panchlora Sp. Gut Microbial Communities From Gamboa, Panama |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Panchlora Sp. Gut → Panchlora Sp. Gut Microbial Communities From Gamboa, Panama |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Panama | |||||||
| Coordinates | Lat. (o) | 9.116667 | Long. (o) | -79.7 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014156 | Metagenome | 265 | Y |
| F030633 | Metagenome | 184 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| PaMGMunAill_c0118007 | Not Available | 672 | Open in IMG/M |
| PaMGMunAill_c0213924 | Not Available | 561 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| PaMGMunAill_c0118007 | PaMGMunAill_01180072 | F030633 | NSRDKYHSERGFLGMFPIMVAPLGEVCGVPRRLL* |
| PaMGMunAill_c0213924 | PaMGMunAill_02139241 | F014156 | MMVTRSLLDDTVIKQLKWYGHVERMGEKRLSTKQAVTWCSTIKK* |
| ⦗Top⦘ |