2236876021: Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS37

Overview

Basic Information

• IMG/M Taxon OID: 2236876021
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0050867 | Gp0053515 | Ga0011272
• Sample Name: Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS37
• Sequencing Status: Permanent Draft
• Sequencing Center: GATC-Biotech AG, Konstanz, Germany
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 269809237
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → saline evaporation pond → saline water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Hypersaline (saline)

Location Information

• Location: Bras del Port Saltern, Santa Pola, Spain
• Coordinates
  • Lat. (^o): 38.11
  • Long. (^o): -0.36
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088354	Metagenome	109	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
SS37_p0049369	Not Available	507

Sequences

Scaffold ID	Protein ID	Family	Sequence
SS37_p0049369	SS37_00493693	F088354	NDNAKTNPTKPMTDTPRTQLDVDRFETAVVNANGQVYLGRDLEGAKVHVAVEIVEDADEQEDPDQ