2236876016: Mine water biofilm microbial communities from Lead, South Dakota, sample from rock fracture pool HS4850BF040511-1

Overview

Basic Information

• IMG/M Taxon OID: 2236876016
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0051017 | Gp0053902 | Ga0011249
• Sample Name: Mine water biofilm microbial communities from Lead, South Dakota, sample from rock fracture pool HS4850BF040511-1
• Sequencing Status: Permanent Draft
• Sequencing Center: University of Florida
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 9921452
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Underground Science And Engineering Laboratory Groundwater Microbial Communities From South Dakota, Us
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Deep Underground Science And Engineering Laboratory Groundwater → Deep Underground Science And Engineering Laboratory Groundwater Microbial Communities From South Dakota, Us

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → mine → groundwater
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Deep Underground Science and Engineering Laboratory, Lead, SD, USA
• Coordinates
  • Lat. (^o): 44.3427
  • Long. (^o): -103.7606
  • Alt. (m): N/A
  • Depth (m): 1478

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043261	Metagenome / Metatranscriptome	156	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
DUSEL06_c02938	All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium	1271

Sequences

Scaffold ID	Protein ID	Family	Sequence
DUSEL06_c02938	DUSEL06_029381	F043261	KCKTHGRASRYEVSPQEREQRRKIALAARIQKETRLRILQSVRQELPGALSRADFEMVALDYFRRLGHDNHHRLFQVYGWEEKKTKTSWGGMSVEHEKLALDRIRSMSIADLNRFMVTCGIVPDLYYSGFGGDDVLSKDSNLSQAASRHKISAAKIASAVRAELSARTRNSRGKKRASKKRKAE