| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2228664019 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045332 | Gp0051641 | Ga0010738 |
| Sample Name | Nasutitermes corniger hindgut microbial communities from Florida, USA - 2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 36853872 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus | 1 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Termite Hindgut Microbial Communities From Amitermes Wheeleri In The Arizona Desert And From Nasutitermes Corniger In Florida, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Digestive System → Hindgut → P3 Segment → Termite Hindgut → Termite Hindgut Microbial Communities From Amitermes Wheeleri In The Arizona Desert And From Nasutitermes Corniger In Florida, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Florida, USA | |||||||
| Coordinates | Lat. (o) | 26.135833 | Long. (o) | -80.129444 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005119 | Metagenome / Metatranscriptome | 411 | Y |
| F026033 | Metagenome / Metatranscriptome | 199 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| NasMGMT1_c112714 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus | 660 | Open in IMG/M |
| NasMGMT1_c112717 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 517 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| NasMGMT1_c112714 | NasMGMT1_1127142 | F026033 | MEFQRTGRYDLMYMKTKELGWKENQGIQNIGIEDSQGNRIVEQSQVLKIWENYITELHDRPNRPVTLEVEPEEEVDADEKGPYILRSEVEKAIKEMRNKKATGDDDTPGDVFKLLGEGGLKIMTKLINTIYETGEWPKAFTEVTMIALKKKPQATKCSDHRT |
| NasMGMT1_c112717 | NasMGMT1_1127172 | F005119 | MRHDKVCTHLHYSICKALGIETADKWYTHMPKPVYEEGDVTVLWNQAVHTDREVTANRPDIIIKNKK |
| ⦗Top⦘ |