2199352026: Bovine rumen microbial communities from Vernon, TX, USA, Sample 669

Overview

Basic Information

• IMG/M Taxon OID: 2199352026
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0046171 | Gp0052340 | Ga0011127
• Sample Name: Bovine rumen microbial communities from Vernon, TX, USA, Sample 669
• Sequencing Status: Permanent Draft
• Sequencing Center: Texas A and M University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 26083354
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Bovine Rumen Microbial Communities From Vernon, Tx, Usa
• Type: Host-Associated
• Taxonomy: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Microbial Communities From Vernon, Tx, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: Vernon, Texas
• Coordinates
  • Lat. (^o): 34.154
  • Long. (^o): -99.264
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081939	Metagenome / Metatranscriptome	114	N

Associated Scaffolds

Scaffold	Taxonomy	Length
rumenmetagenome__Contig_4166	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella	4078

Sequences

Scaffold ID	Protein ID	Family	Sequence
rumenmetagenome__Contig_4166	rumenmetagenome_00057000	F081939	MLADKLNEAIESCNFEPTEELDLFAEAVALLIAYWGKVSDWTPIEKASYVGYVTTTVMEKGLDVAIKDFDEYRKSLNTKFGN