| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2166559009 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047475 | Gp0052407 | Ga0010968 |
| Sample Name | Human fecal microbial communities from France, for comparison studies - Human3 (F2-w 0943) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | 454 Life Sciences |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 9266757 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Environmental And Host-Associated → Microbial Communities From The Atlantic Ocean And Human Feces From France, Grouped Together For A Comparative Study |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | St. Chamond, France | |||||||
| Coordinates | Lat. (o) | 45.460129 | Long. (o) | 4.495284 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080673 | Metagenome | 115 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| BAAY01017054 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 939 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| BAAY01017054 | Human3-_00125250 | F080673 | LATIEINMDEIELLRLQDEALSYLRDNITKDEAYYILTTDKDIIEILIADKKDGSKRIKILDAEYTIEKDDMLFLFDTDGVIDECLLVASYIGVNMYFRRQDVNAILNNINREKVMKYPYIAIQLDYIQTVEKRRVVFEITGHRMDDNKERIRFYVCLIYG |
| ⦗Top⦘ |