2162886008: Soil microbial communities from Puerto Rico rain forest, that decompose switchgrass - Feedstock-adapted consortia SG + Fe

Overview

Basic Information

• IMG/M Taxon OID: 2162886008
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0063182 | Gp0052032 | Ga0026247
• Sample Name: Soil microbial communities from Puerto Rico rain forest, that decompose switchgrass - Feedstock-adapted consortia SG + Fe
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 154120208
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From Puerto Rico Rain Forest, That Decompose Switchgrass
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Soil → Soil Microbial Communities From Puerto Rico Rain Forest, That Decompose Switchgrass

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): forest biome → tropical forest → forest soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Luquillo LTER tropical forest, Puerto Rico
• Coordinates
  • Lat. (^o): 18.3724
  • Long. (^o): -65.7166
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088999	Metagenome / Metatranscriptome	109	Y
F096286	Metagenome	105	N

Associated Scaffolds

Scaffold	Taxonomy	Length
PRSSGFe2_Sequence0000001033	All Organisms → cellular organisms → Bacteria	12852

Sequences

Scaffold ID	Protein ID	Family	Sequence
PRSSGFe2_Sequence0000001033	PRSSGFe2_0033.00001310	F096286	VNRRRVKTVRLKHEHSALIDPSMKGKKVDHIRFSQAERSIVYVSVVFDDRTEWSIAIESFSLPTARVSHFVTIEEDPIAETGLMFLPDDSSSYPQFDQIQQPPKQRKPSKKSKK
PRSSGFe2_Sequence0000001033	PRSSGFe2_0033.00001350	F088999	MNNKLLLMLCAFLAVAVSATAQETSDKFAIFVTGVGDATPVAQSLVKKLNASKPFEVVSKNDIAKVVVLVSCSSRKQTDPFLCMYVAHFNGPAFKTFLGGGMWAATNADAVSDNFLASIAQDIVERFDSTSKENLREALQACLLMTDSKCNVPDPLQKEFDAKQLTLGQYLLKKNQ