NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2140918012

2140918012: Sediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, sample from flow sorted anaerobic no nitrate



Overview

Basic Information
IMG/M Taxon OID2140918012 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0060820 | Gp0051515 | Ga0026320
Sample NameSediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, sample from flow sorted anaerobic no nitrate
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size47869084
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationLake Washington, Seattle
CoordinatesLat. (o)47.676484Long. (o)-122.228394Alt. (m)N/ADepth (m)62
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050936Metagenome / Metatranscriptome144Y
F065431Metagenome127Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
contig00868Not Available2810Open in IMG/M
contig03443Not Available1012Open in IMG/M
contig04088Not Available894Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
contig00868LWFCAn3_00833770F050936MELSNDEVSFLNENIVLKDYFYDLLLNIKNSNETKIILCKNSYERRFVHILAISLGLYHSRYGDWSDWFKKYRDYQETVDKIDGQDHYKIVGVKVSTKLLLLSRKDKIHQECK
contig03443LWFCAn3_00390890F065431MVDYCSICLKEETLSDFAEGTTFTEVDDKLYCVNCFEDLGDSIIFCERCCKFGHRNENFDENFVKSLDYDSNVIYYHIKCLFETEKCPICKDYLKNKDCLDVFIDYGCKIEYHKSCVEDKNNIFEFDICEECGISLRVKCESCNHRFMDCYNDNCCNKNGSCYDGRYDGNCSACNW
contig04088LWFCAn3_00836710F065431MNDYCFICSKEYTLSLCAEGEYFTQVNDREYCVNCFEDLGDSIIFCERCCKFEHRNENFDENFVKSLDYNSNVIYYHIKCLFETEKCPICKDYLKNKECVDVFVDYDFNIEYHKSCVEDKNNVFKFDICEYCGISLRVKCESCERRFGDCYNEDCKNYGYDQYEESGRYDGNCSACNW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.