2124908031: Obsidian Pool

Overview

Basic Information

• IMG/M Taxon OID: 2124908031
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0054916 | Gp0052312 | Ga0010899
• Sample Name: Obsidian Pool
• Sequencing Status: Permanent Draft
• Sequencing Center: HudsonAlpha Institute for Biotechnology, Oak Ridge National Laboratory
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 8362165
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hot Spring Nanoarchaeal Communities From Obsidian Pool, Yellowstone National Park
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Nanoarchaeal Communities From Obsidian Pool, Yellowstone National Park

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → spring water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Obsidian Pool, Yellowstone National Park, USA
• Coordinates
  • Lat. (^o): 44.6
  • Long. (^o): -110.433
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021808	Metagenome / Metatranscriptome	217	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
OB25_ConsensusfromContig2362	All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1	527

Sequences

Scaffold ID	Protein ID	Family	Sequence
OB25_ConsensusfromContig2362	OB25_00063590	F021808	MNEEPPYGTTAWFFYEIDEKQRQIYELVFDIEEKIAKIKDLLNEIDLLKAQLETNINVGK