2061766005: Elkhorn Slough cyanobacterial mat night

Overview

Basic Information

• IMG/M Taxon OID: 2061766005
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0060828 | Gp0051486 | Ga0026395
• Sample Name: Elkhorn Slough cyanobacterial mat night
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 55432056
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hypersaline Mat Water Microbial Communities From Elkhorn Slough, California, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Microbial Mats → Hypersaline Mat Water → Hypersaline Mat Water Microbial Communities From Elkhorn Slough, California, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): estuarine biome → estuary → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Surface (saline)

Location Information

• Location: Elkhorn Slough, Monterey Bay, CA
• Coordinates
  • Lat. (^o): 36.82188
  • Long. (^o): -121.744
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010070	Metagenome / Metatranscriptome	308	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
CGUI_GFCP3IQ02HW3CD	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii	504

Sequences

Scaffold ID	Protein ID	Family	Sequence
CGUI_GFCP3IQ02HW3CD	CGUI_00943930	F010070	QMKXRGQPHLCAGLNANMYTTCIENLESILRTDKAVVYWLKNGCMHMDATGPEIVRPCPALSICSWTANLFAQPPSLVRDGVESLCPKDPKFLPTIPQEYRSLLNPAEQQNAAATGPKSF