| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2042536001 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045762 | Gp0051616 | Ga0011072 |
| Sample Name | Human fecal microbial communities from Cork, Ireland - EM039 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI), Macrogen |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 100614185 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus atrophaeus | 1 |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctjsp22 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From University College Cork, Ireland, Of The Elderly Irish Population |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Cork, Ireland | |||||||
| Coordinates | Lat. (o) | 51.907 | Long. (o) | -8.472 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036964 | Metagenome / Metatranscriptome | 169 | Y |
| F074964 | Metagenome | 119 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Irish_EM03_contig00126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Bacillus → Bacillus subtilis group → Bacillus atrophaeus | 884 | Open in IMG/M |
| Irish_EM03_GD660IW02IXHJJ | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctjsp22 | 502 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Irish_EM03_contig00126 | Irish_EM039_993690 | F074964 | NGADLKAICKTLEIPAEYAVKVAALAKDKKRLVAVCSQMLPKVGDTFVKFSLYSKVYKDNKVDKEKGIEAKTADWCAENVIYGGEYKSFGFSTAETLETKKSAKWLVKETDEYKATYVAVKIKSYSIRTIAKCVSEYLTHESNQQ |
| Irish_EM03_GD660IW02IXHJJ | Irish_EM039_2219850 | F036964 | MEILKIVFPLLMVAGALGSLVVNIASKGDWATSLQWLGACLLYTALTARNVN |
| ⦗Top⦘ |