| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2038011001 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045251 | Gp0051583 | Ga0011021 |
| Sample Name | Coalbed microbial communities from New Mexico, USA - 342 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Virginia Polytechnic Institute and State University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 98800478 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Coalbed Water Microbial Communities From New Mexico, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From New Mexico, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → coal mine → underground water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | New Mexico | |||||||
| Coordinates | Lat. (o) | 36.728056 | Long. (o) | -108.220833 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011593 | Metagenome / Metatranscriptome | 289 | Y |
| F037503 | Metagenome / Metatranscriptome | 168 | Y |
| F045124 | Metagenome / Metatranscriptome | 153 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Coalbed1142_GAKB3UI02ISJBC | Not Available | 502 | Open in IMG/M |
| Coalbed1142_GAKB3UI02IZQFE | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 527 | Open in IMG/M |
| Coalbed1142_GAKB3UI02JVXYY | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 501 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Coalbed1142_GAKB3UI02ISJBC | Coalbed4_61220 | F045124 | VTDDTTLQATIYETRQDVRWIKEALSEIKKANQKQDGRIADIETTIARRSGRDGALAAIVSAVVAFVVAFVSGGWLR |
| Coalbed1142_GAKB3UI02IZQFE | Coalbed4_2897860 | F037503 | MHLGAASESRVIEVELLIGCEGFAAYQIQTNSECYNLYLAVSPWVLRSTDERERTQTIS |
| Coalbed1142_GAKB3UI02JVXYY | Coalbed4_939680 | F011593 | VTDNLAAPEWCRGCPDPIYDDRRGEWDWYCRQHSPTGIKCNNVAVLRERCYRVREYFSNREATLWAALLF |
| ⦗Top⦘ |