2029527002: Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2-

Overview

Basic Information

• IMG/M Taxon OID: 2029527002
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0059646 | Gp0051363 | Ga0026397
• Sample Name: Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2-
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 113475182
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From Face And Otc Sites In Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Soil Microbial Communities From Face And Otc Sites In Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): desert biome → research facility → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Nevada Desert Research Center
• Coordinates
  • Lat. (^o): 36.766667
  • Long. (^o): -115.95
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023527	Metagenome / Metatranscriptome	209	Y
F104556	Metagenome / Metatranscriptome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
NTS_CREO_AM_FWG71BA01A1UA4	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae	504
NTS_CREO_AM_FWG71BA01CEL13	Not Available	505

Sequences

Scaffold ID	Protein ID	Family	Sequence
NTS_CREO_AM_FWG71BA01A1UA4	NTS_CREO_AMB_2209700	F023527	VAALYCSCEQKPQMWGEFWWTGGKYAWIFFDDRETSETYTERITHCPACGQRLERKNLEAVTYPA
NTS_CREO_AM_FWG71BA01CEL13	NTS_CREO_AMB_1322800	F104556	LATLVSSTSAVGGCPILFASPAERSNVSAYDEAEGDALRLLRAIDAEQTHGRVGASVFAFAAARSAGLRPGTERYEEALWRLVCEEALTVDEHIPPEVAAKVPFGRAPYRLAPAAVRMLAKA