x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 2020627003
2020627003: Benzene-degrading bioreactor microbial communities from Toronto, Ontario, Canada, that are methanogenic - September 2009 gDNA_4
Overview
| Basic Information |
| IMG/M Taxon OID | 2020627003 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0056621 | Gp0051431 | Ga0025772 |
| Sample Name | Benzene-degrading bioreactor microbial communities from Toronto, Ontario, Canada, that are methanogenic - September 2009 gDNA_4 |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 33465768 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Benzene-Degrading Bioreactor Microbial Communities From Toronto, Ontario, Canada, That Are Methanogenic |
| Type | Engineered |
| Taxonomy | Engineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor → Benzene-Degrading Bioreactor Microbial Communities From Toronto, Ontario, Canada, That Are Methanogenic |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | na → na → na |
| Location Information |
| Location | Toronto, Ontario |
| Coordinates | Lat. (o) | 43.658712 | Long. (o) | -79.396003 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F085346 | Metagenome | 111 | Y |
| F103319 | Metagenome / Metatranscriptome | 101 | N |
| F105440 | Metagenome / Metatranscriptome | 100 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| BDM_C7434 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | 1228 | Open in IMG/M |
| BDM_GGZN16678_b1 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 798 | Open in IMG/M |
| BDM_GGZN7227_g1 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 848 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| BDM_C7434 | BDMC_625640 | F103319 | MADQYNSIGHHPKSTYMTSEGHALHNISGLDLIIDIAGVYFPLRSINYAANHNVTDEHGTGTHDPVALTNQEHTYTGTFTYASFLVTGENVLTQKDVLTLTQLLQDQADEGVSKYFDIYIIEVQGKRTPGTGTTFEEQVEAALQNESMVGYINALVDCKVTKVNRDIPEKNTVVSSREFKYSYMLPR |
| BDM_GGZN16678_b1 | BDMC_309480 | F105440 | MQSAEAKDSTINYRRLQADRSISLLYNPATGDGKFSTKLAARAELANGYYEAFPQIDYAQSLQENNAKLAKHGWPEHRGI |
| BDM_GGZN7227_g1 | BDMC_458020 | F085346 | MKKIMKGGFKLDEVASAQREFEGQIKLINAVVSAFGIVSKNKRALVGLQRMNLMDDTTAIDLMLGDPEVDKVNCPIKEGLILRSDCLDYSGSHHEDCKGCEIGHATKELLCPIPKSWPQP |