2014031002: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP1 Alice Springs, Crater Hills

Overview

Basic Information

• IMG/M Taxon OID: 2014031002
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0045212 | Gp0051340 | Ga0026356
• Sample Name: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP1 Alice Springs, Crater Hills
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 9888965
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → hot spring → spring water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: Yellowstone National Park, WY
• Coordinates
  • Lat. (^o): 44.6533633
  • Long. (^o): -110.4776669
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035135	Metagenome / Metatranscriptome	173	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
YNP1_FWPF21940_g1	Not Available	837

Sequences

Scaffold ID	Protein ID	Family	Sequence
YNP1_FWPF21940_g1	YNP1_108790	F035135	ESLLPNSIYSQQFISSFFFDFIDTNDSYISLTFLMKNVFRIYLDVWKKQIEFVDYLREFKDEFESTYNYYQELLFTTKQNIFEKTGIISCFFTFDDDLREILTIYTNELFCNFIDKLK