x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 2012990006
2012990006: Hot spring microbial communities from Joseph's Coat Spring Transect A, Yellowstone National Park, USA - YSTONE1 (JC3A)
Overview
| Basic Information |
| IMG/M Taxon OID | 2012990006 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0045192 | Gp0051306 | Ga0011168 |
| Sample Name | Hot spring microbial communities from Joseph's Coat Spring Transect A, Yellowstone National Park, USA - YSTONE1 (JC3A) |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 8157880 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80 | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Hot Spring Microbial Communities From Yellowstone National Park |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | aquatic biome → hot spring → spring water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information |
| Location | Joseph's Coat Spring Transect A, Yellowstone National Park, USA |
| Coordinates | Lat. (o) | 44.731451 | Long. (o) | -110.7113131 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F105516 | Metagenome | 100 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| JC3AJCVIAssemblies_1106445189435 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Caldivirga → unclassified Caldivirga → Caldivirga sp. MU80 | 1226 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| JC3AJCVIAssemblies_1106445189435 | JC3AJCVIAssemblies_32450 | F105516 | MPRAIVRVLALGRVSLNLKTFRVTASERLSVDSDGTVNCLGGDCSANGTFITLETEHPNPRELYDALKKVRVLELEVEIHGLPNWLLSRLEFLVGKPTSDKVRYTWHKMPSFGELALVLNDLNLNA |
