NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2007309000

2007309000: Hot spring microbial communities from Yellowstone Bath Hot Springs, Wyoming, USA - Filamentous sample



Overview

Basic Information
IMG/M Taxon OID2007309000 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0045212 | Gp0051059 | Ga0027797
Sample NameHot spring microbial communities from Yellowstone Bath Hot Springs, Wyoming, USA - Filamentous sample
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size10490501
Sequencing Scaffolds4
Novel Protein Genes6
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.2
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationUSA: Wyoming
CoordinatesLat. (o)44.560318Long. (o)-110.8338344Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013155Metagenome / Metatranscriptome274Y
F038745Metagenome / Metatranscriptome165Y
F051572Metagenome / Metatranscriptome144N
F075483Metagenome / Metatranscriptome119Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
2007309369All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.1033Open in IMG/M
2007310383All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum2159Open in IMG/M
2007312189All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum2467Open in IMG/M
2007315643All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.746Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
20073093692007310093F013155VTVWLLRLLFTVWRTFQKIVFTLDDFDFERLARQYLNGETPLSESVNVRVSENKEEGYKEITVTKTYRKPLDAKEAWEGIVKQMAQELQ
20073096162007310702F075483MFTVVKSGEVGFWVRTVDVLGVVMPQFEVSKVVIKVRWLFSEELHLTHSLRIYDVAMDSSSRYFYKEWRAWLNGDDRYRCEVEKPRGLARIYTKAIDVYCRKVKKDEKKEVVILPSRWRKRRYKRWTKPEPGGSAPS
20073103832007312986F038745MDKAVVVVCGELMQISLAFSAYYPLCLGGPPCDFAEAVERLIRRAASARGAEELVEALGGRVRLEELGLPDPALEVLAEELGSEPRWLDALAASFFRLYLGLGRRRRVDGRDLALALCLWAQKKRREDPRNPLWRAAELKPDKLYTDEEAREALEMEERLFRRLWRRALAFHRGEKAYGFQLILAALSLMAAPPRSV
20073103832007312987F051572VHGGPFAEVWTFADVVLEGGCKKSPQFLNTRLELCVLAALIKTAPAGSMVRLRPEIVRRLVEELAAAAGRDRERIRNALLKKAGEVLAQLRRELGDKTPAEALLAKLAELFLKELA
20073121892007318229F038745MDKAVVVVCGELMQISLAFSAYYPLCSGGPPCAYAEAVERLIRRAASARGAEELLEALGGRVRLEELGLPDPALEVLAEELGPEPPWLDALAASFFRLYLGLGRRRRIDGRDLALALCLWAQKKRREDPRNPLWRAAELKPDRLYTEEEARKALNIEERLFRRLWRRALAFHRGEKAYGFQLILAALSLMAAPPRSV
20073156432007322841F013155MEFYQVAVIAIALANLAVTVWLLRLLLPVWQTLRKVVFAMDSYDFDRLAKQFLSNEKPLAETIDVKVSEKKEEGYRELTVTRVYKKPLDAKEVWEGIVRQMAEKLQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.