2004247008: Hypersaline mat microbial communities from Guerrero Negro, Mexico - 22-34 mm depth into microbial mat

Overview

Basic Information

• IMG/M Taxon OID: 2004247008
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0055744 | Gp0051069 | Ga0028945
• Sample Name: Hypersaline mat microbial communities from Guerrero Negro, Mexico - 22-34 mm depth into microbial mat
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 8382678
• Sequencing Scaffolds: 1
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hypersaline Mat Microbial Communities From Guerrero Negro, Baja California Sur, Mexico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Microbial Mats → Hypersaline Mat → Hypersaline Mat Microbial Communities From Guerrero Negro, Baja California Sur, Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): aquatic biome → saline evaporation pond → microbial mat material
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Hypersaline (saline)

Location Information

• Location: Guerrero Negro, Baja California Sur, Mexico
• Coordinates
  • Lat. (^o): 27.68908
  • Long. (^o): -113.917
  • Alt. (m): N/A
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015419	Metagenome / Metatranscriptome	255	Y
F083361	Metagenome / Metatranscriptome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
2004354518	All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium	695

Sequences

Scaffold ID	Protein ID	Family	Sequence
2004353046	2004359492	F083361	LRLALLVLEATNVAPQAVLARVVGLNQDRSVRLYKQRLQEEGLAGLFDHPIPGRPAITTKTEVEKALLQVILEAVIQEHALPDDTFLAERVNQSLQETQEPKVTASMVETIRLRWGIRRPNLTQQLQAAQTSASPEPEQARLGQTRVGGAFILAVLLVETGWLQLTHLLPMAANYAVTATQWLLTAIFTVIFGVRRAFHLDDVRDIGFALVTGRPRPLTHSTFQYLLHAIPGEKARAFYA
2004354518	2004361027	F015419	MKYELKITDENGNEHLYNVSRSSFDEERSLNDFILEALQVSEDKRKLPLITQCPNGLEVYPKIKMKFENYGSSLLGDELEAMAIGWQ