| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2004247002 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0055744 | Gp0051063 | Ga0028939 |
| Sample Name | Hypersaline mat microbial communities from Guerrero Negro, Mexico - 2-3 mm depth into microbial mat |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 8286576 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hypersaline Mat Microbial Communities From Guerrero Negro, Baja California Sur, Mexico |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Microbial Mats → Hypersaline Mat → Hypersaline Mat Microbial Communities From Guerrero Negro, Baja California Sur, Mexico |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → saline evaporation pond → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Guerrero Negro, Baja California Sur, Mexico | |||||||
| Coordinates | Lat. (o) | 27.68908 | Long. (o) | -113.917 | Alt. (m) | N/A | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003188 | Metagenome / Metatranscriptome | 502 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2004274217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 784 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| 2004274217 | 2004276462 | F003188 | MIDPKKKLRETLFSIHKLSYRIKVTEPPKDLMEKKLFIEIMETLRKIEDRRDFMQEEIGMDMTLYEDEFFLVIENLLKLHFSKEQLALIQLYLYQLTPDKDWDGTITIERDKKEQVVEFKTPADVWKIISAL |
| ⦗Top⦘ |