| Basic Information | |
|---|---|
| Taxon OID | 7000000736 Open in IMG/M |
| Scaffold ID | SRS014235_WUGC_scaffold_70483 Open in IMG/M |
| Source Dataset Name | Human stool microbial communities from NIH, USA - visit 1, subject 763678604 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4405 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | National Institutes of Health, USA | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F075480 | Metagenome | 119 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SRS014235_WUGC_scaffold_70483__gene_137022 | F075480 | AGGAG | MNKTKQEKWQRAYGDTPDSFRQRVASALPKGEESRHVAFPRRAMVLAAALVLVLTTAYAAVVTQTELVWNAGHPIENEADDRLGLLTGKAGTSGDSLTIGGVTFTVQDGIYSPETGQLFASAVISADESVQLVGVESDMEWEVRAVTPVSEKLDPSGISWAEWAEQNGKTLVPIGMEAAPTLQFLKVNGQTTDTPLIGAFLTQNPDGTVSAGFQVDLTEADTSHLKSCEVQLECRVGAFGKDGKATQWQKEILIATITFK |
| ⦗Top⦘ |