NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold C3427511

Scaffold C3427511


Overview

Basic Information
Taxon OID7000000721 Open in IMG/M
Scaffold IDC3427511 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 1, subject 763577454
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)883
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Kingella → Kingella oralis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064818Metagenome128N

Sequences

Protein IDFamilyRBSSequence
C3427511__gene_182254F064818N/AYPIPNNINGNTSKLYFTNHKSIVVLLPYFTYMDKDEFLKKLIAFIADNSSELHPKVFKNKIRFGINKSSYTEMRFDYSQNYKGFYLQLASYSRDVGDFFEQEMGNAFLKMLEDESKEFRNLFFAQNSFQLSHYYYGFPIMTNDDTGHLYPEMGTTIFNDILRNLQANHFKFIQAAEVLSPDLLHYIKRFPSCFFNTALVALLIIEKKLLSLDDERVQGLFEYDNMVTKNECKLFSPFDLIFGKKDYQQTAKQRILQRK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.