NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold C493554

Scaffold C493554


Overview

Basic Information
Taxon OID7000000683 Open in IMG/M
Scaffold IDC493554 Open in IMG/M
Source Dataset NameHuman buccal mucosa microbial communities from NIH, USA - visit 1, subject 686765762
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)875
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctSdk10(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027205Metagenome195N
F036281Metagenome170N

Sequences

Protein IDFamilyRBSSequence
C493554__gene_15158F036281AGGAGMITLIKVDEGPVDIYELRMQYLAKLKQTDGVMLPTFIYRNKDLFITEFKPTCDDQWIMYMTNSEGLITKMRIKNGDLMSNGSVLFLAEDRKTYNAKEYFDYWAAREGKPAPFFYESRQYHVKSFMRVPGSTDLWITAERERDHWYTFRMSDDQK
C493554__gene_15159F027205N/APLIERTHVASRLIVSADDILKAVKESEAFERKALSEARKRDRAEGKEPRETLYPNPDLKPGREIVLDYIKNPERRRTPRCSVHLEKRTANNSYRFIVDVSQVRNRELADEIEKDLFAFMDYLLDEYDIPRRIKRSTK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.