NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS063932_LANL_scaffold_36217

Scaffold SRS063932_LANL_scaffold_36217


Overview

Basic Information
Taxon OID7000000651 Open in IMG/M
Scaffold IDSRS063932_LANL_scaffold_36217 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 159510762
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3470
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F097526Metagenome104Y

Sequences

Protein IDFamilyRBSSequence
SRS063932_LANL_scaffold_36217__gene_46503F097526GGAMTTNDTKAITIYTQDDYRRLCERLDDNTVTALLHAHIRAFAADGSQALLKRLTEGLRIAGEMEKAGRNGHPDPAEQARRERWDCQFTVLQQQARMAHCEIVNADNAAVSRLTRQCEKNGSCDTAIPLPRDDYGFAAALRDFPLNEHQTALLWRMALLTIAEITDATPSLVAHYLNGIGGEHLGRALAGKTVYPVT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.