NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS017521_Baylor_scaffold_56738

Scaffold SRS017521_Baylor_scaffold_56738


Overview

Basic Information
Taxon OID7000000498 Open in IMG/M
Scaffold IDSRS017521_Baylor_scaffold_56738 Open in IMG/M
Source Dataset NameHuman stool microbial communities from NIH, USA - visit 1, subject 160502038
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3695
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F078006Metagenome117N
F085718Metagenome111N

Sequences

Protein IDFamilyRBSSequence
SRS017521_Baylor_scaffold_56738__gene_126729F085718AGGAGMVIEFDFEIYKNGDYDKVYLRNGKEPRVLCDNGKGNSPMVVMIEDDKADDYIILRYNETGRRNINGQSGLDLMLSIKEREPELWVVVISYMDNKDKRQKMVLPNFFSKNIRGNIYLQGSSKSSVSYYVDKLEEDKCFDELCEKIRVKRDRIYNMEIISLSDDE
SRS017521_Baylor_scaffold_56738__gene_126730F078006N/AMGDNILRKAADELKKAGCRVFAWQDDTYNRGWSKGDYTMLYYAFPDSPNIGYLSHGEYGMSVAYSRAYIPSCGSGSGCCVKEEATFDLETALDVLNGPLPRWCRSYGVYPKQYDNIDKWYNSDNHNKKLFKEI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.