NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS024277_LANL_scaffold_28142

Scaffold SRS024277_LANL_scaffold_28142


Overview

Basic Information
Taxon OID7000000405 Open in IMG/M
Scaffold IDSRS024277_LANL_scaffold_28142 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit 2, subject 158944319
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4651
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Porphyromonadaceae → Porphyromonas → Porphyromonas gingivalis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040149Metagenome162N
F055792Metagenome138N

Sequences

Protein IDFamilyRBSSequence
SRS024277_LANL_scaffold_28142__gene_34841F055792GAGGVEIAGEALDSTSAVAHRILLLTTQLGESLLASLGAENGVIAEAMVSGALERDLAIDCALEEVRPVLIDKGDDGTEAGTTWGRYPLETLQKESNILFEGSMLPCEACGVDPRCSVKSLDLEPRIIGKAIEAVALPDVTCLDESIPLQRIGGLRDLLVTPDVSETDHLQTPREEGTDLLQLMGIIARKYQLFHTFVS
SRS024277_LANL_scaffold_28142__gene_34842F040149GAGGVAYEGAEELRWKVLIEEQGIPVLFVEVVAWYDGRVSSSEILRSVGVALEREPRLAPVWSHDSEDAINDFIYDTSVPKGHTLTAVRERETVVAQLLNIHRYVYYP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.