Scaffold SRS022609_Baylor_scaffold_90780

Overview

Basic Information

• Taxon OID: 7000000187
• Scaffold ID: SRS022609_Baylor_scaffold_90780
• Source Dataset Name: Human stool microbial communities from the National Institute of Health, USA - subject 158499257, visit 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4995
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location

• Location Name: USA: Maryland: Natonal Institute of Health
• Coordinates
  • Lat. (^o): 39.0042816
  • Long. (^o): -77.1012173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082714	Metagenome	113	N

Sequences

Protein ID	Family	RBS	Sequence
SRS022609_Baylor_scaffold_90780__gene_172476	F082714	AGGA	MVVGIRFAADAPVRTVLQAVLLIFSTADVDFLVREYWVCTFGNGLPERRFTAQEMQRALDALTPDEHAELFTIYALPHNAPGTPPSSCEDFCARGFTMAFYAYDGDGYALLAQSEEQVEAVIETLQKAVEIRSVEAVECETLARWHF