NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRS011306_Baylor_scaffold_84049

Scaffold SRS011306_Baylor_scaffold_84049


Overview

Basic Information
Taxon OID7000000109 Open in IMG/M
Scaffold IDSRS011306_Baylor_scaffold_84049 Open in IMG/M
Source Dataset NameHuman tongue dorsum microbial communities from NIH, USA - visit 1, subject 158944319
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2954
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → Chryseobacterium gleum(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081454Metagenome114N

Sequences

Protein IDFamilyRBSSequence
SRS011306_Baylor_scaffold_84049__gene_108436F081454N/AMKTFKLVLLLFITSASLVFGQEKRYFFKHEFQPNSKYLIKYKTDMDGGYKFVGSKEVIDKIGMDGVKMTINSDIESAISTQKKQGNNVPFILEYTKYFYKAEINGETVNRKIPLQGVKLIGDIVNGKKMEVKNVEGNIDEDTKKILTESIKQFSAIDTDFPKEGLKIGDSFDVVVPYKQSTQWGDIEMIMNIKYTLLKVEKEEAYFDMLIDFVMGDKNVKNMDLSASGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.