| Basic Information | |
|---|---|
| Taxon OID | 3300034820 Open in IMG/M |
| Scaffold ID | Ga0373959_0119129 Open in IMG/M |
| Source Dataset Name | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 644 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil → Populus Rhizosphere Microbial Communities From Soil In West Virginia And Oregon, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: West Virginia, United States | |||||||
| Coordinates | Lat. (o) | 39.6589 | Long. (o) | -79.9058 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000646 | Metagenome / Metatranscriptome | 962 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0373959_0119129_131_595 | F000646 | N/A | LSSTANRPKQRRRGFDHLSSAPISVVLVKEEKMKINKLLLLVILASFSASLGFAKSKAETRDITGCLSKGDSANEFLLKANDGSTWEVKSSNVALADHVGHTVTATGVVSNAKMHNMKEDAKDAAKDSGMTKSNEEHGHLKVTDVKMVSDSCQQ |
| ⦗Top⦘ |