NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0373948_0115389

Scaffold Ga0373948_0115389


Overview

Basic Information
Taxon OID3300034817 Open in IMG/M
Scaffold IDGa0373948_0115389 Open in IMG/M
Source Dataset NamePopulus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)645
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil → Populus Rhizosphere Microbial Communities From Soil In West Virginia And Oregon, United States

Source Dataset Sampling Location
Location NameUSA: West Virginia, United States
CoordinatesLat. (o)39.6589Long. (o)-79.9058Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017413Metagenome / Metatranscriptome241Y

Sequences

Protein IDFamilyRBSSequence
Ga0373948_0115389_6_644F017413N/AMKLDAVERLAQKRVSNARLALGAVVLVSVLAGLGLLFRLSYVPARVAMPVLVAVSAIDGAMTLAVVVLYRSAMRGLHDDLRLAFGEQAGWREKPDQAGQETTRPAKRRRGGRPLVVLSEGGRYPPLLTFLATVAFLGFAAACVVAFARDSLMPFTITSIVLAGLFLISVLPVVIPAIWAGEGPRRAAQGIFYVMLGGQPVSYGEITAGHAETA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.