Scaffold Ga0373573_0245134

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0373573_0245134

Scaffold Ga0373573_0245134

Overview

Basic Information
Taxon OID	3300034782 Open in IMG/M
Scaffold ID	Ga0373573_0245134 Open in IMG/M
Source Dataset Name	Sediment microbial communities from coastal wetland in Texas, United States - D0606M02
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	567
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Coastal Wetland In Texas, United States

Source Dataset Sampling Location
Location Name	USA: Texas
Coordinates	Lat. (^o)	27.8962	Long. (^o)	-97.0386	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025653	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0373573_0245134_52_249	F025653	AGGAG	MSDPIKYFETKLKNLCLAELQAYKKRLDENITQKIAQTAPNEQIAPLILYRGIVEHEMKKRMGEK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.