| Basic Information | |
|---|---|
| Taxon OID | 3300034782 Open in IMG/M |
| Scaffold ID | Ga0373573_0099636 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from coastal wetland in Texas, United States - D0606M02 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 845 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Wetlands → Sediment → Sediment → Sediment Microbial Communities From Coastal Wetland In Texas, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Texas | |||||||
| Coordinates | Lat. (o) | 27.8962 | Long. (o) | -97.0386 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052283 | Metagenome / Metatranscriptome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0373573_0099636_302_520 | F052283 | AGGAG | MNTQQKSVILGAIFGAVLGALGGYLFTRGLEVPREEEEQGLSLRSLPPGAVVSLFIAIMGVLRGIAELGEQV |
| ⦗Top⦘ |