Scaffold Ga0372840_212042

Overview

Basic Information

• Taxon OID: 3300034695
• Scaffold ID: Ga0372840_212042
• Source Dataset Name: Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 575
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Pacific Ocean: Gulf of Alaska
• Coordinates
  • Lat. (^o): 50.0
  • Long. (^o): -145.0
  • Depth (m): 500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102053	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0372840_212042_3_122	F102053	N/A	SKRDSIRSNEDRDFEVRNFIQSNEFLYYYHQGVANQARQ