| Basic Information | |
|---|---|
| Taxon OID | 3300034695 Open in IMG/M |
| Scaffold ID | Ga0372840_097280 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 877 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean: Gulf of Alaska | |||||||
| Coordinates | Lat. (o) | 50.0 | Long. (o) | -145.0 | Alt. (m) | Depth (m) | 500 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026291 | Metagenome / Metatranscriptome | 198 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0372840_097280_2_136 | F026291 | AGG | MLDHFSQSELACPTTGKVRLAAGFGEALEHLRVELDEPIYLNSAC |
| ⦗Top⦘ |