| Basic Information | |
|---|---|
| Taxon OID | 3300034692 Open in IMG/M |
| Scaffold ID | Ga0373917_0095979 Open in IMG/M |
| Source Dataset Name | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A0.3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 506 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry → Uranium-Contaminated Sediments Microbial Communities After Treatment In Bioreactor, Oak Ridge, Tennessee, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oak Ridge, Tennessee | |||||||
| Coordinates | Lat. (o) | 36.0103 | Long. (o) | -84.2696 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042031 | Metagenome / Metatranscriptome | 159 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0373917_0095979_142_348 | F042031 | GGAG | MGVLSDLRKFVRQHGSCGVLAIHLDPPQETTYCIEITCRRCATALSRTVDADAAAWDLVHTDLLLAMN |
| ⦗Top⦘ |