Scaffold Ga0314783_169348

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0314783_169348

Scaffold Ga0314783_169348

Overview

Basic Information
Taxon OID	3300034662 Open in IMG/M
Scaffold ID	Ga0314783_169348 Open in IMG/M
Source Dataset Name	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	516
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil → Soil Microbial Communities From West Virginia University Organic Research Farm, Morgantown, Wv, United States

Source Dataset Sampling Location
Location Name	USA: West Virginia
Coordinates	Lat. (^o)	39.6475	Long. (^o)	-79.9369	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059855	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0314783_169348_203_514	F059855	GGA	MRKIAVAFTAMTLALSMLAQSVPAMAAAGYDSSYAGESAFVSLAPGQSNEFQVFFANTGTTTWTVGTSTEVDLAACLEDKTTCNAQDATEATWNSGWKSATRYA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.