Scaffold Ga0326751_027244

Overview

Basic Information

• Taxon OID: 3300034658
• Scaffold ID: Ga0326751_027244
• Source Dataset Name: Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 524_CTD
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 564
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 13.5136
  • Long. (^o): -44.9626
  • Depth (m): 2427

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035969	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0326751_027244_378_563	F035969	GAGG	MATRHTYASSDDLRDYLAGTSFSSGWTSDAGSIRRILEAASRRIDLYCEGGTFGPLTETRYY